PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_11.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 161aa    MW: 17932.3 Da    PI: 9.4869
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_11.70genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY64.71.6e-2088139859
                                  EEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   8 rKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  rK G   +k+++ prsYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
  evm.model.supercontig_11.70  88 RKGGSSRMKKATRPRSYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 139
                                  899999*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007746.6E-1488140IPR003657WRKY domain
SuperFamilySSF1182906.54E-1788140IPR003657WRKY domain
PfamPF031061.5E-1588139IPR003657WRKY domain
PROSITE profilePS5081118.78588141IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.6E-1788139IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MDSRHDLNHN QPLLFSALTS SDPNYVFGTT PTSLLPSSSL HPASDQVLPH DIYNWADLLC  60
GQPVMGSSSS MGGNGGSHEQ DKTQKDKRKG GSSRMKKATR PRSYYRCTHH TCNVKKQVQR  120
LSKDTSIVVT TYEGIHNHPC EKLMETLTPL LKQMQFLSRF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015584103.12e-47PREDICTED: probable WRKY transcription factor 43
TrEMBLA0A067HEP81e-47A0A067HEP8_CITSI; Uncharacterized protein
STRINGGLYMA18G47350.12e-41(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64000.12e-36WRKY DNA-binding protein 56